CoV2D BrowserTM

CoV2D project home | Random page
Parikh vectors
8TQX_1 1KDF_1 4GQC_1 Letter Amino acid
0 7 18 L Leucine
0 10 17 V Valine
0 3 14 E Glutamic acid
0 6 3 M Methionine
0 0 9 F Phenylalanine
0 3 4 S Serine
0 2 16 K Lycine
0 4 10 N Asparagine
5 0 3 C Cysteine
0 3 2 Q Glutamine
5 3 6 G Glycine
0 0 1 H Histidine
0 4 5 I Isoleucine
0 5 5 T Threonine
0 3 7 R Arginine
0 3 11 D Aspartic acid
0 6 10 P Proline
0 0 2 W Tryptophan
0 1 6 Y Tyrosine
4 7 15 A Alanine

8TQX_1|Chains A, B[auth D]|Zika virus stem-loop A (SLA) bottom stem|Zika virus (64320)
>1KDF_1|Chain A|ANTIFREEZE PROTEIN|Macrozoarces americanus (8199)
>4GQC_1|Chains A, B, C, D|Thiol peroxidase|Aeropyrum pernix (272557)
Protein code \(c\) LZ-complexity \(\mathrm{LZ}(w)\) Length \(n=|w|\) \(\frac{\mathrm{LZ}(w)}{n /\log_{20} n}\) \(p_w(1)\) \(p_w(2)\) \(p_w(3)\) Sequence \(w=f(c)\)
8TQX , Knot 9 19 0.46 8 12 16
UGAUCUGGGCCCAGUAUCA
1KDF , Knot 38 70 0.76 32 63 68
MNQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVKGYAAKDEL
4GQC , Knot 81 164 0.84 40 124 159
MKGLVELGEKAPDFTLPNQDFEPVNLYEVLKRGRPAVLIFFPAAFSPVCTKELCTFRDKMAQLEKANAEVLAISVDSPWCLKKFKDENRLAFNLLSDYNREVIKLYNVYHEDLKGLKMVAKRAVFIVKPDGTVAYKWVTDNPLNEPDYDEVVREANKIAGELVA

Let \(P_w(n)\) be the set of distinct subwords (intervals) in a word \(w\). Let \(p_w(n)\) be the cardinality of \(P_w(n)\). Let \(f(c)\) be the sequence in FASTA with 4-symbol Protein Data Bank code \(c\).

\(|P_{f(8TQX_1)}(2) \setminus P_{f(1KDF_1)}(2)|=12\), \(|P_{f(1KDF_1)}(2) \setminus P_{f(8TQX_1)}(2)|=63\). Let \( Z_k(x,y)=|P_x(k)\setminus P_y(k)|+|P_y(k)\setminus P_x(k)| \) be a LZ76 style (set of subwords) Jaccard distance numerator for \(P(k)\).Hydrophobic-polar version of Sequence 1:0110001110001101001
Pair \(Z_2\) Length of longest common subsequence
8TQX_1,1KDF_1 75 1
8TQX_1,4GQC_1 134 2
1KDF_1,4GQC_1 123 3

Newick tree

 
[
	4GQC_1:71.03,
	[
		8TQX_1:37.5,1KDF_1:37.5
	]:33.53
]

Let d be the Otu--Sayood distance d.
Let d1 be the Otu--Sayood distance d1. (This makes the 4TYN sequence AAAAAA a close match...)
A roughly speaking expected distance is \((0.85)(0.8)(\frac{89 }{\log_{20} 89}-\frac{19}{\log_{20}19})=27.2\)
Status Protein1 Protein2 d d1/2
Query variables 8TQX_1 1KDF_1 37 22.5
Was not able to put for d
Was not able to put for d1

In notation analogous to [Theorem 16, Kjos-Hanssen, Niraula and Yoon (2022)],
\[ \delta= \alpha \mathrm{min} + (1-\alpha) \mathrm{max}= \begin{cases} d &\alpha=0,\\ d_1/2 &\alpha=1/2 \end{cases} \]

Graphviz Engine:
Graphviz Engine: