CoV2D BrowserTM

CoV2D project home | Random page
Parikh vectors
6AFH_1 5NIU_1 6EGL_1 Letter Amino acid
6 4 0 N Asparagine
3 2 1 C Cysteine
4 7 2 Q Glutamine
0 1 1 W Tryptophan
3 8 0 Y Tyrosine
24 12 6 A Alanine
5 3 0 M Methionine
9 5 1 S Serine
15 8 8 E Glutamic acid
10 7 0 I Isoleucine
18 12 8 L Leucine
3 3 0 F Phenylalanine
8 5 0 T Threonine
19 12 0 V Valine
18 6 1 G Glycine
9 8 0 D Aspartic acid
3 8 1 H Histidine
16 9 7 K Lycine
9 3 0 P Proline
7 5 0 R Arginine

6AFH_1|Chain A|Protein/nucleic acid deglycase DJ-1|Homo sapiens (9606)
>5NIU_1|Chains A, B, C, D|Programmed cell death 1 ligand 1|Homo sapiens (9606)
>6EGL_1|Chain A|Apo-(GRAND CoilSerL12(DLE)L16C)3|synthetic construct (32630)
Protein code \(c\) LZ-complexity \(\mathrm{LZ}(w)\) Length \(n=|w|\) \(\frac{\mathrm{LZ}(w)}{n /\log_{20} n}\) \(p_w(1)\) \(p_w(2)\) \(p_w(3)\) Sequence \(w=f(c)\)
6AFH , Knot 86 189 0.79 38 124 182
MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVLKD
5NIU , Knot 65 128 0.82 40 100 121
AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYAAALEHHHHHH
6EGL , Knot 14 36 0.46 20 18 22
EWEALEKKLAALESKCQALEKKLQALEKKLEALEHG

Let \(P_w(n)\) be the set of distinct subwords (intervals) in a word \(w\). Let \(p_w(n)\) be the cardinality of \(P_w(n)\). Let \(f(c)\) be the sequence in FASTA with 4-symbol Protein Data Bank code \(c\).

\(|P_{f(6AFH_1)}(2) \setminus P_{f(5NIU_1)}(2)|=87\), \(|P_{f(5NIU_1)}(2) \setminus P_{f(6AFH_1)}(2)|=63\). Let \( Z_k(x,y)=|P_x(k)\setminus P_y(k)|+|P_y(k)\setminus P_x(k)| \) be a LZ76 style (set of subwords) Jaccard distance numerator for \(P(k)\).Hydrophobic-polar version of Sequence 1:110001111110110010011110110011101011111100110000011101010100100011001111111011100100011100110000000111111011101111001111001000111000110110000000010001111000111001011111101101001110101111100
Pair \(Z_2\) Length of longest common subsequence
6AFH_1,5NIU_1 150 3
6AFH_1,6EGL_1 124 3
5NIU_1,6EGL_1 98 4

Newick tree

 
[
	6AFH_1:74.24,
	[
		6EGL_1:49,5NIU_1:49
	]:25.24
]

Let d be the Otu--Sayood distance d.
Let d1 be the Otu--Sayood distance d1. (This makes the 4TYN sequence AAAAAA a close match...)
A roughly speaking expected distance is \((0.85)(0.8)(\frac{317 }{\log_{20} 317}-\frac{128}{\log_{20}128})=58.3\)
Status Protein1 Protein2 d d1/2
Query variables 6AFH_1 5NIU_1 74 61.5
Was not able to put for d
Was not able to put for d1

In notation analogous to [Theorem 16, Kjos-Hanssen, Niraula and Yoon (2022)],
\[ \delta= \alpha \mathrm{min} + (1-\alpha) \mathrm{max}= \begin{cases} d &\alpha=0,\\ d_1/2 &\alpha=1/2 \end{cases} \]