CoV2D BrowserTM

CoV2D project home | Random page
Parikh vectors
6TLQ_1 3KWG_1 6BAQ_1 Letter Amino acid
2 2 0 W Tryptophan
16 8 22 V Valine
7 1 2 C Cysteine
22 9 5 E Glutamic acid
12 7 10 K Lycine
8 1 1 Y Tyrosine
5 11 10 D Aspartic acid
21 7 5 H Histidine
34 12 55 L Leucine
7 8 1 M Methionine
7 9 12 T Threonine
15 3 11 Q Glutamine
12 8 29 G Glycine
11 13 16 I Isoleucine
13 6 3 F Phenylalanine
7 6 18 P Proline
17 10 10 A Alanine
18 7 2 R Arginine
6 5 16 N Asparagine
23 8 16 S Serine

6TLQ_1|Chain A|Nuclear receptor ROR-gamma|Homo sapiens (9606)
>3KWG_1|Chains A, B|Non-structural protein 1|Influenza A virus (381517)
>6BAQ_1|Chains A, B, C, D, E, F, G, H|BPI fold-containing family A member 1|Mus musculus (10090)
Protein code \(c\) LZ-complexity \(\mathrm{LZ}(w)\) Length \(n=|w|\) \(\frac{\mathrm{LZ}(w)}{n /\log_{20} n}\) \(p_w(1)\) \(p_w(2)\) \(p_w(3)\) Sequence \(w=f(c)\)
6TLQ , Knot 119 263 0.84 40 167 251
GSSHHHHHHSSGLVPRGSHMASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLHKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFS
3KWG , Knot 67 141 0.78 40 114 134
MAHHHHHHVDDDDKMTMASTPASRYITDMTIEELSRDWFMLMPKQKVEGPLCIRIDQAIMDKNIMLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSFPGHTIEDVKNAIGVLIGGLEANDNTVRVSKTLQRFAWGS
6BAQ , Knot 96 244 0.72 38 122 212
SNAQGPPLPLNQGQLLPLAQGLPLAVSPALPSNPTDLLAGKFTDALSGGLLSGGLLGILENIPLLDVIKSGGGNSNGLVGGLLGKLTSSVPLLNNILDIKITDPQLLELGLVQSPDGHRLYVTIPLGLTLNVNMPVVGSLLQLAVKLNITAEVLAVKDNQGRIHLVLGDCTHSPGSLKISLLNGVTPVQSFLDNLTGILTKVLPELIQGKVCPLVNGILSGLDVTLVHNIAELLIHGLQFVIKV

Let \(P_w(n)\) be the set of distinct subwords (intervals) in a word \(w\). Let \(p_w(n)\) be the cardinality of \(P_w(n)\). Let \(f(c)\) be the sequence in FASTA with 4-symbol Protein Data Bank code \(c\).

\(|P_{f(6TLQ_1)}(2) \setminus P_{f(3KWG_1)}(2)|=108\), \(|P_{f(3KWG_1)}(2) \setminus P_{f(6TLQ_1)}(2)|=55\). Let \( Z_k(x,y)=|P_x(k)\setminus P_y(k)|+|P_y(k)\setminus P_x(k)| \) be a LZ76 style (set of subwords) Jaccard distance numerator for \(P(k)\).Hydrophobic-polar version of Sequence 1:10000000000111101001101001001100100000000010100110000011000010100000110110001001001100110110010111010000011110111101111010010010000111010011101101110001100110100010110100001110011111010011100000100100010111000100000001110111010100100001001011001011110111111000110
Pair \(Z_2\) Length of longest common subsequence
6TLQ_1,3KWG_1 163 6
6TLQ_1,6BAQ_1 177 4
3KWG_1,6BAQ_1 152 3

Newick tree

 
[
	6TLQ_1:87.88,
	[
		3KWG_1:76,6BAQ_1:76
	]:11.88
]

Let d be the Otu--Sayood distance d.
Let d1 be the Otu--Sayood distance d1. (This makes the 4TYN sequence AAAAAA a close match...)
A roughly speaking expected distance is \((0.85)(0.8)(\frac{404 }{\log_{20} 404}-\frac{141}{\log_{20}141})=79.0\)
Status Protein1 Protein2 d d1/2
Query variables 6TLQ_1 3KWG_1 98 75.5
Was not able to put for d
Was not able to put for d1

In notation analogous to [Theorem 16, Kjos-Hanssen, Niraula and Yoon (2022)],
\[ \delta= \alpha \mathrm{min} + (1-\alpha) \mathrm{max}= \begin{cases} d &\alpha=0,\\ d_1/2 &\alpha=1/2 \end{cases} \]