CoV2D BrowserTM

CoV2D project home | Random page
Parikh vectors
5YPY_1 6FAN_1 5EHM_1 Letter Amino acid
10 4 12 V Valine
8 1 8 Q Glutamine
4 4 24 G Glycine
7 6 17 I Isoleucine
9 10 24 L Leucine
5 1 23 S Serine
1 0 4 W Tryptophan
0 0 11 Y Tyrosine
8 4 9 D Aspartic acid
2 1 3 C Cysteine
4 10 20 E Glutamic acid
5 3 10 F Phenylalanine
3 1 9 P Proline
5 1 20 T Threonine
3 3 18 A Alanine
5 5 14 R Arginine
7 2 12 N Asparagine
4 1 2 H Histidine
4 6 21 K Lycine
4 0 7 M Methionine

5YPY_1|Chains A, B, C, D|Acetolactate synthase isozyme 1 small subunit|Escherichia coli (strain K12) (83333)
>6FAN_1|Chains A, B, C, D, E, F|CooT|Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) (246194)
>5EHM_1|Chains A, B|RE06730p,CG3822|Drosophila melanogaster (7227)
Protein code \(c\) LZ-complexity \(\mathrm{LZ}(w)\) Length \(n=|w|\) \(\frac{\mathrm{LZ}(w)}{n /\log_{20} n}\) \(p_w(1)\) \(p_w(2)\) \(p_w(3)\) Sequence \(w=f(c)\)
5YPY , Knot 54 98 0.84 38 87 96
GSMQNTTHDNVILELTVRNHPGVMTHVCGLFARRAFNVEGILCLPIQDSDKSHIWLLVNDDQRLEQMISQIDKLEDVVKVQRNQSDPTMFNKIAVFFQ
6FAN , Knot 34 63 0.74 34 51 59
GCEASAFIVNGDKEELFLERVDKLIPTEEGLLLENIFGQRKVIKAKIKRLELVDHRILLERED
5EHM , Knot 120 268 0.83 40 176 257
GSANLKNKTLVVTTILSNPYCMRKESAIPLSGNDQFEGYAVDLIHEISKSLGFNYKIQLVPDGSYGSLNKLTGEWNGMIRELLEQRADLAIADLTITFEREQAVDFTTPFMNLGVSILYRKGTPIESAEDLAKQTRIKYGALKGGSTAAFFRDSKISTYQRMWSFMESARPSVFTASNGEGVERVAKGKGSYAFLMESTSIEYVTERNCELTQVGGMLDTKSYGIATPPNSPYRTAINSVILKLQEEGKLHILKTKWWKEKRGGGKCR

Let \(P_w(n)\) be the set of distinct subwords (intervals) in a word \(w\). Let \(p_w(n)\) be the cardinality of \(P_w(n)\). Let \(f(c)\) be the sequence in FASTA with 4-symbol Protein Data Bank code \(c\).

\(|P_{f(5YPY_1)}(2) \setminus P_{f(6FAN_1)}(2)|=68\), \(|P_{f(6FAN_1)}(2) \setminus P_{f(5YPY_1)}(2)|=32\). Let \( Z_k(x,y)=|P_x(k)\setminus P_y(k)|+|P_y(k)\setminus P_x(k)| \) be a LZ76 style (set of subwords) Jaccard distance numerator for \(P(k)\).Hydrophobic-polar version of Sequence 1:10100000001110101000111100101111001101011101110000000111110000010011001001001101000000101100111110
Pair \(Z_2\) Length of longest common subsequence
5YPY_1,6FAN_1 100 3
5YPY_1,5EHM_1 187 3
6FAN_1,5EHM_1 165 3

Newick tree

 
[
	5EHM_1:97.63,
	[
		5YPY_1:50,6FAN_1:50
	]:47.63
]

Let d be the Otu--Sayood distance d.
Let d1 be the Otu--Sayood distance d1. (This makes the 4TYN sequence AAAAAA a close match...)
A roughly speaking expected distance is \((0.85)(0.8)(\frac{161 }{\log_{20} 161}-\frac{63}{\log_{20}63})=33.5\)
Status Protein1 Protein2 d d1/2
Query variables 5YPY_1 6FAN_1 44 34
Was not able to put for d
Was not able to put for d1

In notation analogous to [Theorem 16, Kjos-Hanssen, Niraula and Yoon (2022)],
\[ \delta= \alpha \mathrm{min} + (1-\alpha) \mathrm{max}= \begin{cases} d &\alpha=0,\\ d_1/2 &\alpha=1/2 \end{cases} \]