CoV2D BrowserTM

CoV2D project home | Random page
Parikh vectors
4QAC_1 1EJQ_1 4JQD_1 Letter Amino acid
22 0 3 V Valine
14 1 9 R Arginine
9 1 5 N Asparagine
9 0 4 Q Glutamine
3 0 1 H Histidine
6 1 2 F Phenylalanine
5 0 1 W Tryptophan
14 2 8 E Glutamic acid
14 1 8 I Isoleucine
12 1 11 L Leucine
1 1 3 M Methionine
27 1 4 S Serine
4 0 0 C Cysteine
5 2 4 G Glycine
9 7 10 K Lycine
11 2 3 P Proline
8 3 4 Y Tyrosine
9 2 11 A Alanine
21 2 5 D Aspartic acid
14 1 2 T Threonine

4QAC_1|Chains A, B, C, D, E, F, G, H, I, J|Acetylcholine-binding protein|Lymnaea stagnalis (6523)
>1EJQ_1|Chains A, B|SYNDECAN-4|null
>4JQD_1|Chains A, B, E, F|Csp231I C protein|Citrobacter sp. RFL231 (315237)
Protein code \(c\) LZ-complexity \(\mathrm{LZ}(w)\) Length \(n=|w|\) \(\frac{\mathrm{LZ}(w)}{n /\log_{20} n}\) \(p_w(1)\) \(p_w(2)\) \(p_w(3)\) Sequence \(w=f(c)\)
4QAC , Knot 99 217 0.81 40 145 210
DYKDDDDKLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEI
1EJQ , Knot 18 28 0.71 30 24 26
RMKKKDEGSYDLGKKPIYKKAPTNEFYA
4JQD , Knot 51 98 0.79 38 80 94
MLIRRLKDARLRAGISQEKLGVLAGIDEASASARMNQYEKGKHAPDFEMANRLAKVLKIPVSYLYTPEDDLAQIILTWNELNEQERKRINFYIRKKAK

Let \(P_w(n)\) be the set of distinct subwords (intervals) in a word \(w\). Let \(p_w(n)\) be the cardinality of \(P_w(n)\). Let \(f(c)\) be the sequence in FASTA with 4-symbol Protein Data Bank code \(c\).

\(|P_{f(4QAC_1)}(2) \setminus P_{f(1EJQ_1)}(2)|=135\), \(|P_{f(1EJQ_1)}(2) \setminus P_{f(4QAC_1)}(2)|=14\). Let \( Z_k(x,y)=|P_x(k)\setminus P_y(k)|+|P_y(k)\setminus P_x(k)| \) be a LZ76 style (set of subwords) Jaccard distance numerator for \(P(k)\).Hydrophobic-polar version of Sequence 1:0000000010010110010000010111000001111010101101101001000101111000010000111000001001011100111101110011001011010110110010110110100010001011000011000101101000000101010000000000100000101101000000100000101000101010100010001
Pair \(Z_2\) Length of longest common subsequence
4QAC_1,1EJQ_1 149 3
4QAC_1,4JQD_1 149 3
1EJQ_1,4JQD_1 80 3

Newick tree

 
[
	4QAC_1:82.86,
	[
		1EJQ_1:40,4JQD_1:40
	]:42.86
]

Let d be the Otu--Sayood distance d.
Let d1 be the Otu--Sayood distance d1. (This makes the 4TYN sequence AAAAAA a close match...)
A roughly speaking expected distance is \((0.85)(0.8)(\frac{245 }{\log_{20} 245}-\frac{28}{\log_{20}28})=73.6\)
Status Protein1 Protein2 d d1/2
Query variables 4QAC_1 1EJQ_1 92 51.5
Was not able to put for d
Was not able to put for d1

In notation analogous to [Theorem 16, Kjos-Hanssen, Niraula and Yoon (2022)],
\[ \delta= \alpha \mathrm{min} + (1-\alpha) \mathrm{max}= \begin{cases} d &\alpha=0,\\ d_1/2 &\alpha=1/2 \end{cases} \]