CoV2D BrowserTM

CoV2D project home | Random page
Parikh vectors
3FZB_1 4ROG_1 1NTC_1 Letter Amino acid
2 0 5 Q Glutamine
4 0 4 H Histidine
9 1 8 T Threonine
3 0 3 W Tryptophan
16 3 12 A Alanine
5 0 5 R Arginine
16 0 4 D Aspartic acid
2 0 3 K Lycine
10 0 6 S Serine
0 2 0 C Cysteine
11 0 8 E Glutamic acid
5 0 0 I Isoleucine
9 0 0 V Valine
7 7 6 G Glycine
5 0 2 M Methionine
6 0 6 P Proline
7 0 0 Y Tyrosine
0 0 1 N Asparagine
12 0 17 L Leucine
5 0 1 F Phenylalanine

3FZB_1|Chains A, B, C, D, E, F, G, H, I, J|Minor tail protein U|Enterobacteria phage lambda (10710)
>4ROG_1|Chain A|D(GGACACGTGGGAG)|null
>1NTC_1|Chains A, B|PROTEIN (NITROGEN REGULATION PROTEIN (NTRC))|Salmonella typhimurium (90371)
Protein code \(c\) LZ-complexity \(\mathrm{LZ}(w)\) Length \(n=|w|\) \(\frac{\mathrm{LZ}(w)}{n /\log_{20} n}\) \(p_w(1)\) \(p_w(2)\) \(p_w(3)\) Sequence \(w=f(c)\)
3FZB , Knot 66 134 0.80 36 101 128
GSHMKHTELRAAVLDALEKHDTGATFFDGRPAVFDEADFPAVAVYLTGAEYTGEELDSDTWQAELHIEVFLPAQVPDSELDAWMESRIYPVMSDIPALSDLITSMVASGYDYRRDDDAGLWSSADLTYVITYEM
4ROG , Knot 7 13 0.46 8 8 10
GGACACGTGGGAG
1NTC , Knot 45 91 0.74 32 68 85
MDLPGELFEASTPDSPSHLPPDSWATLLAQWADRALRSGHQNLLSEAQPELERTLLTTALRHTQGHKQEAARLLGWGAATLTAKLKELGME

Let \(P_w(n)\) be the set of distinct subwords (intervals) in a word \(w\). Let \(p_w(n)\) be the cardinality of \(P_w(n)\). Let \(f(c)\) be the sequence in FASTA with 4-symbol Protein Data Bank code \(c\).

\(|P_{f(3FZB_1)}(2) \setminus P_{f(4ROG_1)}(2)|=98\), \(|P_{f(4ROG_1)}(2) \setminus P_{f(3FZB_1)}(2)|=5\). Let \( Z_k(x,y)=|P_x(k)\setminus P_y(k)|+|P_y(k)\setminus P_x(k)| \) be a LZ76 style (set of subwords) Jaccard distance numerator for \(P(k)\).Hydrophobic-polar version of Sequence 1:10010000101111011000001101101011110010111111010110001001000010101010111110110001011100010111001111001100111010000000011110010100110001
Pair \(Z_2\) Length of longest common subsequence
3FZB_1,4ROG_1 103 2
3FZB_1,1NTC_1 121 3
4ROG_1,1NTC_1 74 2

Newick tree

 
[
	3FZB_1:61.25,
	[
		4ROG_1:37,1NTC_1:37
	]:24.25
]

Let d be the Otu--Sayood distance d.
Let d1 be the Otu--Sayood distance d1. (This makes the 4TYN sequence AAAAAA a close match...)
A roughly speaking expected distance is \((0.85)(0.8)(\frac{147 }{\log_{20} 147}-\frac{13}{\log_{20}13})=49.6\)
Status Protein1 Protein2 d d1/2
Query variables 3FZB_1 4ROG_1 64 34
Was not able to put for d
Was not able to put for d1

In notation analogous to [Theorem 16, Kjos-Hanssen, Niraula and Yoon (2022)],
\[ \delta= \alpha \mathrm{min} + (1-\alpha) \mathrm{max}= \begin{cases} d &\alpha=0,\\ d_1/2 &\alpha=1/2 \end{cases} \]